SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000404 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000404
Domain Number 1 Region: 293-572
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-82
Family Kelch motif 0.00000373
Further Details:      
 
Domain Number 2 Region: 24-134
Classification Level Classification E-value
Superfamily POZ domain 7.72e-35
Family BTB/POZ domain 0.00088
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000000404
Domain Number - Region: 152-267
Classification Level Classification E-value
Superfamily ARM repeat 0.0902
Family MIF4G domain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000404   Gene: ENSOGAG00000000451   Transcript: ENSOGAT00000000451
Sequence length 608
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:22321300:22331447:-1 gene:ENSOGAG00000000451 transcript:ENSOGAT00000000451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMESTTASTRFHQPHMERKMSAMTCEIFNELRLEGKLCDVVIKVNGFEFNAHKNILCSC
SSYFRALFTSGWNNTEKKVYNIPGISPDMMKLIIEYAYTRTVPITPDNVEKLLAAADQFN
IMGIVRGCCEFLKSELCLDNCIGICKFTDYYYCPELRQKAYMFILHNFEEMVKVSAEFLE
LSVTELKDIIEKDELNVKQEDAVFEAILKWISHDPQNRKQHIAILLPKVRLALMHAEYFM
NNVKMNDYVKDSEECKPVIINALKAMYDLNMNGPSNSDFTNPLTRPRLPYAILFAIGGWS
GGSPTNAIEAYDARADRWVNVTCEEESPRAYHGAAYLKGYVYIIGGFDSVDYFNSVKRFD
PVKKTWHQVAPMHSRRCYVSVTVLSNFIYAMGGFDGYVRLNTAERYEPETNQWTLIAPMH
EQRSDASATTLYGKVYICGGFNGNECLFTAEVYNTESNQWTVIAPMRSRRSGIGVIAYGE
HVYAVGGFDGANRLRSAEAYSPVANTWRTIPTMFNPRSNFGIEVVDDLLFVVGGFNGFTT
TFNVECYDEKTDEWYDAHDMSIYRSALSCCVVPGLANVGEYAARRDNFTGLALRDEVKYS
ASTSTLPV
Download sequence
Identical sequences H0WGF8
ENSOGAP00000000404 ENSOGAP00000000404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]