SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000535 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000535
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.44e-33
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.15e-18
Family Ribosomal protein L11, C-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000535   Gene: ENSOGAG00000000597   Transcript: ENSOGAT00000000598
Sequence length 165
Comment pep:known_by_projection scaffold:OtoGar3:GL873533.1:30170678:30175259:-1 gene:ENSOGAG00000000597 transcript:ENSOGAT00000000598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHNGNITFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAV
Download sequence
Identical sequences H0WGS5
ENSOGAP00000000535 ENSOGAP00000000535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]