SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000573 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000573
Domain Number 1 Region: 11-216
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-31
Family G proteins 0.0000676
Further Details:      
 
Domain Number 2 Region: 472-578
Classification Level Classification E-value
Superfamily POZ domain 9.99e-21
Family BTB/POZ domain 0.0096
Further Details:      
 
Domain Number 3 Region: 241-296,394-455
Classification Level Classification E-value
Superfamily POZ domain 2.24e-18
Family BTB/POZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000573   Gene: ENSOGAG00000000636   Transcript: ENSOGAT00000000638
Sequence length 696
Comment pep:known_by_projection scaffold:OtoGar3:GL873527.1:23938152:23977046:1 gene:ENSOGAG00000000636 transcript:ENSOGAT00000000638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METDMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTRYQLLATHVPTVWAIDQYR
VCQEVLERSRDVVDEVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKT
MWYQEIKHFCPRTPVVLVGCQLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKE
LGIPYYETSVFDQFGIKDVFDNAIRAALISRRHLQFWKSHLKKVQKPLLQAPFLPPKAPP
PVIKIPACPSTGTNEAACLLDNPLCADVLFVLQDREHIFAHRIYLATSSSKFYDLFLMEC
EESPSWGEGACENEKQGRDFQGRTVSVDSDERGEDGPPRTPQAEQWESSSRTPPETVGLE
AEGLAPETQTLSGWSKGFVGMHKEMQVNPISKRAGPVTVVRMDSSVQPGPFRTLLRFLYT
GQLDEKEKDLVGLAQIAEVLEMFDLRMMVENIMNKEAFMNQEITKAFHVRKANRIKECLS
KGTFSDVTFKLDDGAISAHKPLLICSCEWMAAMFGGSFVESANSEVYLPNINKISMQAVL
DYLYTKQLSPNLDLDPLELIALANRFCLPHLVALAEQHAVQELTKAAMSGVGIDGEVLSY
LELAQFHNAHQLAAWCLHHICTNYNSVCSKFRKEIKSKSADNQEYFERHRWPPVWYLKEE
DHYQRVKREREKEDIALKKHHSRRKWCFWNSSPAVA
Download sequence
Identical sequences H0WGV5
ENSOGAP00000000573 XP_003783683.1.62490 ENSOGAP00000000573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]