SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000599 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000599
Domain Number 1 Region: 319-603
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-61
Family Kelch motif 0.0000841
Further Details:      
 
Domain Number 2 Region: 52-167
Classification Level Classification E-value
Superfamily POZ domain 1.41e-30
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000599   Gene: ENSOGAG00000000666   Transcript: ENSOGAT00000000666
Sequence length 621
Comment pep:known_by_projection scaffold:OtoGar3:GL873685.1:2598812:2657628:-1 gene:ENSOGAG00000000666 transcript:ENSOGAT00000000666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWMAGQRGAWTMGDVVEKSLEGPLAPSADETSQKRGDLVEILNGDKVKFDDTGLSLILQN
GLETLRGENALTDVILCVDIQEFACHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDA
ETMHTLLDYTYTSKALITKHNVQRVLEAANLFQFLRMVDACASFLTEALNPENCVGILRL
ADTHSLDSLKKQVQNYIIQNFVQILNSEEFLELPVDTLYYILKSDDLYVTEEAQVFETVM
SWVRHKQSERLCLLPYVLENVRLPLLDPWYFVDTVEADPLIRQCPEVFPLLQEARMYHLS
GNEIISERTKPRMHEFQSEVFMIIGGCTKDERFVAEVTCLDPLRRSRLEVAKLPLTEHEL
ESENKKWVEFACVTLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMVVLG
GKVYVIGGFDGLQRINNVETYDPFHNCWSEASPLLVHVSSFAATSHKKKLYVIGGGPNGK
LATDKTQCYDPVTNKWNLKSAMPVEAKCINAVSFRDRIYVVGGAMRALYAYSPLEDSWCL
VTQLSHERASCGIAPCNNKLYITGGRDEKNEVIATVLCWDPEAQKLTEECVLPRGVSHHG
SVTIRKSYTHIRRIVPGAVSV
Download sequence
Identical sequences H0WGY0
XP_003800145.1.62490 ENSOGAP00000000599 ENSOGAP00000000599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]