SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000634 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000634
Domain Number 1 Region: 85-652
Classification Level Classification E-value
Superfamily Urocanase 5.89e-223
Family Urocanase 0.0000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000634   Gene: ENSOGAG00000000708   Transcript: ENSOGAT00000000709
Sequence length 677
Comment pep:known_by_projection scaffold:OtoGar3:GL873620.1:475525:511126:-1 gene:ENSOGAG00000000708 transcript:ENSOGAT00000000709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCLQALCSGLPLRPLPENQGLWAGVPHAPVRTPGLNFEEKQLALRNALRYFPPDIQELL
APEFAQELRLYGHIYMYRFCPNIEMKAYPIEQYPCRVRAAAAIMHMIMNNLDPAVAQFPQ
ELVTYGGNGQVFSNWAQFWLTMSYLSKMTEEQTLVMYSGHPLGLFPSSPNAPRLVITNGM
VIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGVEDLA
GKVFVTSGLGGMSGAQAKAAVITGCIGVIAEVDKAALEKRHKQGWLMEVTDSLDHCIQRL
REARKKKEVLSLGYHGNVVELWERLVHVLDTTGELLVDLGSDQTSCHNPFNGGYYPVQLS
FTDAQSLMASDPAAFKGLVQESLRRHVSAINRLAKEKFFFWDYGNAFLLEAQRAGADVGK
KGASKTEFRYPSYVQHIMGDIFSQGFGPFRWVCTSGDPKDLTVTDQLAMSVLEQAIADGV
KVSVKQQYMDNIRWIREAAKHQLVVGSQARILYSDQKGRVAIAVAINQAIARGKIKQAPV
VLSRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGWGE
VINGGFGLVLDGTPEAEQKARMMLSWDVSNGVARRCWSGNQKAYDIICQTMQENNGLVVT
LPHEVGDKLVLQQALQL
Download sequence
Identical sequences H0WH12
ENSOGAP00000000634 ENSOGAP00000000634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]