SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000658 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000658
Domain Number 1 Region: 951-1219
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-68
Family Protein kinases, catalytic subunit 0.0000371
Further Details:      
 
Domain Number 2 Region: 128-227
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000733
Family N-terminal PAS domain of Pas kinase 0.0000109
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000000658
Domain Number - Region: 309-348
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00366
Family Heme-binding PAS domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000658   Gene: ENSOGAG00000000734   Transcript: ENSOGAT00000000735
Sequence length 1247
Comment pep:known_by_projection scaffold:OtoGar3:GL873652.1:5072127:5110685:-1 gene:ENSOGAG00000000734 transcript:ENSOGAT00000000735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRCSVVEEDQRGPSGSTPLTVPVERPASQTISKSSKSLSAARRHLSRKNGLSKLCQSR
MALSEDKWSSYCLSSLAAQNICTSKLYCPAALEHAGSQASVSCCSLLQGLSAGWSAPLLP
APVCNPNKAVFTVDAKTTEILVANDKACRLLGCSSHSLVGQKLAQFFLKSDSAVLEALSE
EHVGADGHAAVVFGTVVDIVSRSGEKVPVSVWMKRLQQERSLCCVVVLEPVERVSASVDF
QSDLPPPGQHVPKNLKIQRSVGRARDGTTFPLSLKLKSKSSSEETDASEVVPQWSYSASV
WVFCTISGLITLLPDGTIYGINHSFALTLFGYGKTELLGKNITFLIPGFYHYMDLAYDSS
LQLPDLASCPDVSNEKGSGEMPTDSWQGWGLAGEVQDPEGSVMLTSDHVLPQDETLKLAG
SRDILTGTQTQRQPGSGGPWSQPPPGVDAVSEGSPPAHSVQLPPEPQRVTALGKEEPGAT
ESPKQGLLEESGSEPVHTQSPASGEASETPVPAEDWKSDAGVCDPRQESWLELAGLSGPS
GINSWASATAEHRAMGQPAGGGLLMHCPRYGGEWGLRPKSQDLTPSPSGVACVSFGTPTL
DEPWLGMKDDREELQTCLIKEQLSSLSFAGAPGITCIELVPAEHTPFPASMSSCDVGGRD
LHGSRPGSSSACYALATDLPGALRAVESQEADMNSFSWNLKELFFSHQTDQTSSSCSYAT
SELIGTPSPSVVGSDLDVSSLLGQSSGVSDDRELLLLTGTRFDLGEGQRFRESCLGCDQA
EPSEVSLVSLEHFEVSDCENPACTLHTADTGPKDAPCSAEEPRLNVQVTSTPVTPGAATL
QREIREGSYSGSCCHRDGLQLSVQFEVKRVELQGPAPLFCCWLVKDLLQSHRDSATRTRL
LLASLPSSAHSISELPGPSPGELLRAKPWFEEAPRAVELEGVAACEGEFSCKYSALSPLG
SGAFGFVWTAVDKEENKQVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIK
VLDVFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRSRNILH
RDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLLGNPYRGPELEM
WSLGVTLYTLIFEENPFCELEETVEAAIHPPYLVSAELMSLVSGLLQPAPEQRTTLEKLV
IDPWVTQPVNLADYTWEEVCRVNKPESGVLSTASLETGSKSLSEAAQ
Download sequence
Identical sequences H0WH29
ENSOGAP00000000658 ENSOGAP00000000658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]