SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000661 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000661
Domain Number 1 Region: 166-269
Classification Level Classification E-value
Superfamily POZ domain 3.73e-18
Family Tetramerization domain of potassium channels 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000661   Gene: ENSOGAG00000000739   Transcript: ENSOGAT00000000739
Sequence length 475
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:42449060:42515825:-1 gene:ENSOGAG00000000739 transcript:ENSOGAT00000000739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRPHPYDSNSSDPENWDRKLHSRPRKLYKHSSTPSRVAKGGVDHTKMSLHGASGGHER
SRDRRRSSDRSRDSSHERTESQLTPCIRNVTSPTRQHHVEREKDHSSSRPSSPRPQKASP
NGSISSAGNSSRNSSQSSSDGSCKTSGEMVFVYENAKEGARNVRTSERVTLIVDNTRFVV
DPSIFTAQPNTMLGRMFGSGREHNFTRPNEKGEYEVAEGIGSTVFRAILDYYKTGIIRCP
DGISIPELREACDYLCISFEYSTIKCRDLSALMHELSNDGARRQFEFYLEEMILPLMVAS
AQSGERECHIVVLTDDDVVDWDEEYPPQMGEEYSQIIYSTKLYRFFKYIENRDVAKSVLK
ERGLKKIRLGIEGYPTYKEKVKKRPGGRPEVIYNYVQRPFIRMSWEKEEGKSRHVDFQCV
KSKSITNLAAAAADIPQDQLVVMHPTPQVDELDILPMHPPSGNNDLDPDAQNPML
Download sequence
Identical sequences H0WH32
ENSOGAP00000000661 ENSOGAP00000000661 XP_003781162.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]