SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000674 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000674
Domain Number 1 Region: 269-367
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.81e-18
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00000365
Further Details:      
 
Domain Number 2 Region: 922-968
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000235
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 
Domain Number 3 Region: 120-184
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000301
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 4 Region: 14-87
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000674   Gene: ENSOGAG00000000754   Transcript: ENSOGAT00000000755
Sequence length 1444
Comment pep:known_by_projection scaffold:OtoGar3:GL873541.1:15735912:15830842:1 gene:ENSOGAG00000000754 transcript:ENSOGAT00000000755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEEYM
CQVLCDLPPQPPPHPPSVKKLSSLQTKWNTYSKIISIDTSSLRAAGRTGWEDLVRKCIYA
FFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFI
MGIHIIDREHSGLSPQDDTNSGMTIPRVNPSVNPNISPAHGVARPATLPPSNNSMVSTRV
NRQQSSDLHSSAHSNSGNSQGNFGCSPGNQIVANVALNQGQASSQSSNPSLNLSNSPMEG
TGMSLAQFMSPRRQVTSGLAARPRMPNSSFPPNISTLSSPVGMTSSACNTSNRSYSNIPV
TSLQGMNEGPNNSVGFSASSPVLRQMSSQNSPGRLNIQPAKAESKDNKEIASILNEMIQS
DNSSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVL
SCTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTS
VSVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKK
EQMDPCNTNPTPMTKPAPEEIKLESQSQFSADLDQFDQLLPTLEKAAQLPGLCETDRMDG
AVTNVAIKSEILPTSLQSTTARPTSRLNRLPELELETIDNQFGQPGTGDQIPWTNNTVTA
VNQNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGID
KLVQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSL
GTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILN
QFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQ
SFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAGNPEASL
ANRNSMVNRGMTGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGEANFAPSLSPGSSMVPM
PIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNINSVFSQAVQNQPTPAQPGVYNNMSI
TVSMAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQISDPALRHTGLYCNQLSSTDLL
KTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQ
LLTE
Download sequence
Identical sequences H0WH45
ENSOGAP00000000674 ENSOGAP00000000674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]