SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000700 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000700
Domain Number 1 Region: 6-434
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-121
Family ALDH-like 0.000000000578
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000700   Gene: ENSOGAG00000000786   Transcript: ENSOGAT00000000787
Sequence length 466
Comment pep:known_by_projection scaffold:OtoGar3:GL873653.1:2575208:2579433:1 gene:ENSOGAG00000000786 transcript:ENSOGAT00000000787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFEDTLRRLREAFATGCTRPAEFRAAQLRGLSRFLQDNKQLLQDALAQDLSKSAFEAD
MSELVICQNEVDLALRNLQAWMKDEPAATNMITKLDSAFIRKEPFGLVLIIAPWNYPVNL
TLVPLVGALAAGNCVVLKPSEISKGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHK
FDYILFTGSPRVGRIVMTAATKYLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYILCSPETQERLLPALQSAITRFYGDDPQSSPNLGRIINQKHFQRLQALLGC
GRVAIGGQSDESERYIAPTVLVDVQETEPVMQEEIFGPILPIMNVRSLDEAIDFITRREK
PLALYAFSNSRQVVDQMLNRTSSGNFGGNEGFIYMLLPSLPLGGVGNSGMGRYHGKFSFD
TFSHHRACLLSHPGLEKLNDLRYPPYTDRSQQLLRWAVGSWTCTLL
Download sequence
Identical sequences H0WH69
ENSOGAP00000000700 XP_003798355.1.62490 ENSOGAP00000000700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]