SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000703 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000703
Domain Number 1 Region: 6-437
Classification Level Classification E-value
Superfamily ALDH-like 1.01e-118
Family ALDH-like 0.000000000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000703   Gene: ENSOGAG00000000789   Transcript: ENSOGAT00000000790
Sequence length 469
Comment pep:known_by_projection scaffold:OtoGar3:GL873653.1:2513185:2526137:-1 gene:ENSOGAG00000000789 transcript:ENSOGAT00000000790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFEDTLRRLREAFATGRTQPAKFRATQLRGLSRFLQDNKQLLLDALAQDLRKSDFESE
VSEIAISQAEVTLALKNLRAWMKNERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNL
TLVPLVGALAAGNCVVLKPSEISNSVEKVLAEVLPRYLDQSCFAVVLGGPQETGQLLEHK
FDYIFFTGSPRVGRIVMTAAAKHLTPVTLELGGKNPCYIDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYILCSPETQERLLPALQSAITRFYGDDPQSSPNLGRIINQKHFQRLQALLGC
GRIAIGGQSDESERYIAPTVLVDVQATELVMQEEIFGPILPILNVQSLDEAIDFITQREK
PLALYAFSNSSQVVKRVLARTSSGGFCGNDGFMHMTLTSLPFGGVAGASGMGRYHGKFSF
DTFSHHRACLLRSPRMEKVNDLRYPPHTPRNLRVLLVAMEARCCSCTLL
Download sequence
Identical sequences H0WH72
ENSOGAP00000000703 ENSOGAP00000000703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]