SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000719 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000719
Domain Number 1 Region: 218-381,414-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-38
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 481-663
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-36
Family cAMP-binding domain 0.00093
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.27e-20
Family Flavin-binding PAS domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000719   Gene: ENSOGAG00000000804   Transcript: ENSOGAT00000000806
Sequence length 1107
Comment pep:known_by_projection scaffold:OtoGar3:GL873521.1:36368132:36761653:1 gene:ENSOGAG00000000804 transcript:ENSOGAT00000000806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKNGSSFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKIIPEDKKEDKVKGRSRTGTHFDSARRRSRAVLYHISGHLQR
REKNKLKINNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVP
YNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLM
SMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRW
SLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHK
FVEDIQHDLTYNLREGHESDVITRLSNKSTVSQSEPKGNGSINKRLPSIVEDEEEEEEEE
EETASLSPIYTRRSSTSRNKKVGSNKSYLGLSLKQLASGTVPFHSPVRVSSSNSPKAKQE
NDPISHGKRKEKNLKLQLSTSNSAGPPDLSPRIVDGIEDGNSSEESQTFDFGSERIRPEP
RISPPLGDPEIGTAVLFIKAEETKQQINKLNNEVTSLTQEVSQLGKDMKNVMQLLENILS
PQQPSRRCSLHTTSVCPSRESLQTRMSWSTHQPCLHLQTGGAAYTQAQLCHSNITSDIWS
MDPSSVRSSPQRTGAHEQNPADSELYHSPNLDYSPSHYQVVQEGHLQFLRCISPHSDTTL
TPLQSISATLSSSVCSSSETSLHLILPSRSEEGSFGQGAVSSFSLENLPVSWKQEGMASV
STKPLENFPLEVVTSTAEVQDNKAINV
Download sequence
Identical sequences H0WH86
XP_003781780.1.62490 ENSOGAP00000000719 ENSOGAP00000000719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]