SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000840 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000000840
Domain Number - Region: 135-202
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0746
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000840   Gene: ENSOGAG00000000937   Transcript: ENSOGAT00000000939
Sequence length 533
Comment pep:known_by_projection scaffold:OtoGar3:GL873529.1:35578481:35594797:1 gene:ENSOGAG00000000937 transcript:ENSOGAT00000000939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVFRVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLSGSLLRCGPGLFEVGSEPFYHL
FDGQALLHKFDFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCRNIFSRFF
SYFRGVEVTDNALVNIYPVGEDYYACTETNFITKVNPETLETIKQVDLCNYVSVNGATAH
PHIESDGTVYNIGNCFGKNFSIAYNIVKIPPLQADKEDPISKSEVVVQFPCSDRFKPSYV
HSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNESMGVWLHIADKKRRKYI
NNKYRTSPFNLFHHINTYEDSGFLIVDLCCWKGFEFVYNYLYLANLRGNWDEVKKSARKA
PQPEVRRYVLPLSMDKADTGKNLVTLPHTTATAVLCSDDTIWLEPEVLFSGPRQAFEFPQ
INYQKYGGRPYTYAYGLGLNHFVPDRLCKLNVRTKETWVWQEPDSYPSEPIFVSHPDALE
EDDGVILSVVVSPGPGQKPAYLLVLNAKDLSEVARAEVEINIPVTFHGLFKKS
Download sequence
Identical sequences H0WHJ1
ENSOGAP00000000840 ENSOGAP00000000840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]