SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000976 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000976
Domain Number 1 Region: 28-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.03e-80
Family Carbonic anhydrase 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000976   Gene: ENSOGAG00000001096   Transcript: ENSOGAT00000001096
Sequence length 290
Comment pep:known_by_projection scaffold:OtoGar3:GL873753.1:59449:190994:-1 gene:ENSOGAG00000001096 transcript:ENSOGAT00000001096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSFIEDSVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREAR
YDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWG
RENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLK
AVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPL
TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences A0A1U7UB18 F1PWG5 G1LGX2 H0WHV5
ENSOGAP00000000976 ENSCAFP00000010611 ENSAMEP00000006163 ENSAMEP00000006163 9615.ENSCAFP00000010611 XP_002915756.1.58354 XP_003802214.1.62490 XP_004588062.1.84141 XP_008065933.1.4292 XP_008704944.1.72690 XP_008704945.1.72690 XP_008704946.1.72690 XP_011218671.1.58354 XP_544094.2.84170 ENSOPRP00000014387 ENSCAFP00000010611 ENSOPRP00000014387 ENSOGAP00000000976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]