SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001147 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001147
Domain Number 1 Region: 188-298,411-561
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.04e-56
Family Phosphate binding protein-like 0.00000882
Further Details:      
 
Domain Number 2 Region: 18-174
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000113
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001147   Gene: ENSOGAG00000001285   Transcript: ENSOGAT00000001286
Sequence length 759
Comment pep:known_by_projection scaffold:OtoGar3:GL873527.1:536410:793505:1 gene:ENSOGAG00000001285 transcript:ENSOGAT00000001286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDSRYYLLNKEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHRISSLLCDPQE
GYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIK
KGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPM
GSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKSLGFKYEIYQAPDG
RYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEE
KISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSSAQPRPSASATLHSAIW
IVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQD
LSKQVEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSSPSEGIR
KAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSVSSKGYGIALQHGSPYRDLFSQRILE
LQDTGDLDVLKQKWWPHTGRCDLTSHTSAQADGKSLKLHSFAGVFCILAIGLLLACLVAA
LELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAP
SQALEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRS
PNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences H0WIA2
ENSOGAP00000001147 ENSOGAP00000001147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]