SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001386 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001386
Domain Number 1 Region: 44-260
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.35e-62
Family Alanine racemase-like, N-terminal domain 0.00000000268
Further Details:      
 
Domain Number 2 Region: 260-322
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.32e-23
Family Eukaryotic ODC-like 0.0000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001386   Gene: ENSOGAG00000001558   Transcript: ENSOGAT00000001559
Sequence length 358
Comment pep:novel scaffold:OtoGar3:GL873541.1:3065217:3071031:-1 gene:ENSOGAG00000001558 transcript:ENSOGAT00000001559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNINNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDVLKKHRRWLKALP
RVTPFYAVKCNDSRAIVKTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVESKAVCRLSVKFGATLKTSRILLERAKELNIDVVGVSFHVGSG
CTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDK
YFPSDSGVRIIAEPGRYYVVDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRP
TIYYVMSGPTWQLVQQIQNPDYLPEVEEQDVGTLPVSCAWESGMKRHPATCASASINV
Download sequence
Identical sequences H0WIV4
ENSOGAP00000001386 ENSOGAP00000001386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]