SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001408 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001408
Domain Number 1 Region: 161-585
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.47e-83
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0077
Further Details:      
 
Domain Number 2 Region: 628-858
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.75e-48
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001408   Gene: ENSOGAG00000001581   Transcript: ENSOGAT00000001584
Sequence length 1010
Comment pep:known_by_projection scaffold:OtoGar3:GL873736.1:2098512:2124642:-1 gene:ENSOGAG00000001581 transcript:ENSOGAT00000001584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQLRLLPSRLGAQATRLLAARDTLVFSWRNRSSGPPATFPSSRGGGGSSYMEEMYFAWL
ENPRSVHKSWDSFFRKASEEASSGSAQPQPLSVIHESRPAVSSRTKTSKLVEDHLAVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLQEADLDKEFQLPTTTF
IGGSESTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEEKRT
LLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRG
RLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVAN
PSHLEAVDPVVQGKTKAEQFYRGDTQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEW
RNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQ
EFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPEDM
LTHIGNMASSVPLEDFRIHTGLSRILRGRADMTKKRTVDWALAEYMAFGSLLKEGIHVRL
SGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYA
MASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSA
RPERFLQMSNDDSDAYPAFTEDFEVRQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPL
IIFTPKSLLRHPEAKSSFDQMVPGTSFQRVIPEDGAAAQAPKQVRRLIFCTGKVYYDLVR
ERSSQGLEEQVAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFM
TILSRARPIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFEGKTF
Download sequence
Identical sequences H0WIX2
ENSOGAP00000001408 ENSOGAP00000001408 XP_012668113.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]