SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001692 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001692
Domain Number 1 Region: 6-192
Classification Level Classification E-value
Superfamily ITPase-like 6.8e-46
Family ITPase (Ham1) 0.000000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001692   Gene: ENSOGAG00000001900   Transcript: ENSOGAT00000001901
Sequence length 204
Comment pep:known_by_projection scaffold:OtoGar3:GL873544.1:12272355:12283963:-1 gene:ENSOGAG00000001900 transcript:ENSOGAT00000001901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLAGKKIVFVTGNSKKLEEEQVIQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQ
EAARQAWGITAVAGFVFSFVPLGHIPGKEVKWFLEKLKPEGLYQLLAGFQDKSAYALCTF
ALSTGDPSEPVRLFRGRTLGQIVMPRGCRDFGWDPCFQPDGYKQTYAEMPKAEKNAISHR
FRALLELQEYFGSLTSPEAGEGGG
Download sequence
Identical sequences H0WJL0
ENSOGAP00000001692 ENSOGAP00000001692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]