SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001708 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001708
Domain Number 1 Region: 1135-1319
Classification Level Classification E-value
Superfamily Fibronectin type III 9.74e-36
Family Fibronectin type III 0.00000288
Further Details:      
 
Domain Number 2 Region: 1539-1740
Classification Level Classification E-value
Superfamily Fibronectin type III 2.81e-35
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 129-247
Classification Level Classification E-value
Superfamily vWA-like 3.06e-34
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 4 Region: 995-1113
Classification Level Classification E-value
Superfamily CalX-like 5.1e-20
Family CalX-beta domain 0.00065
Further Details:      
 
Domain Number 5 Region: 632-721
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.97e-16
Family Integrin beta tail domain 0.0037
Further Details:      
 
Domain Number 6 Region: 27-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000162
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 545-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number 8 Region: 587-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family Integrin beta EGF-like domains 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000001708
Domain Number - Region: 515-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00642
Family Integrin beta EGF-like domains 0.039
Further Details:      
 
Domain Number - Region: 474-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001708   Gene: ENSOGAG00000001913   Transcript: ENSOGAT00000001917
Sequence length 1835
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:6178048:6212973:-1 gene:ENSOGAG00000001913 transcript:ENSOGAT00000001917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPHPRLWTRLLLAALLSTSLPGAMANLCKKAQVKSCTECIRVDKDCAYCTDEMFKERR
CNTQAELLAAGCRQGSVVVMESSFQIIEETQIDTTLRRSQVSPQSLRVRLRPGEEQHFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLARVLSQLTSDYTIGFGKFVDKVTV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVEEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRGHEQPAMGSEALERISRSLQLSFLKTSLDFLNGPQKTKNQNCPYFHHHQIAGH
LISNQRILFPFPYLRSLESVYLYIMLKFCFFFTYHYHKHFLSCTYFNCHFLYILAEAWCL
WLKQLRASHIHLSWRVQIQPRPTKQQRRLQQVMAHAVNKLSPGSAPVAQAAKGTYQVHLR
AIEDIDGTPVCQLPVEDQKGNIHLKPSFSDGLRMDVGIICDMCACELQKEVQSARCNFQG
DFTCGHCVCSEGWSGKTCNCSTGSLSDMQPCLQEGDDKPCSGRGECQCGHCVCYGEGRYE
GQFCEYDNFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNG
RGHCECGRCHCNQQSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECS
FKVKMVDELKKAVGAAEEVVEFCSFRDEDDDCTYSYTVEGDGTPGPNSTVLVHRKKDCPP
GSFWWLIPLLLFLLLLLALLLLLCWKYCACCRACLALLPCCNRGHMVGFKEDHYMLRENL
MASDHLDTPMLRSGNLKGRDTVRWKVTNNMQRPGFATHAASTNPTELGEGWGWVLGLLPV
SLGPLGPPDPSFAWQLNEVYRHISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLTAPRSAK
QALLKLTEKHVEQGSFHELKVAPGYYTLTTDQDARGMVEFQEGVELVDVRVPLFIRPEDD
DEKQLLVEAIDVPVGTATLGRRLVNITIIKEQASGMVFFEQPEYSVTRGEKVARIPVVRR
ILDSGKSQVSYRTQDNTAQGNRDYVPVEGELLFHPGETWKELQVKLLELQEVDSLLRGRQ
TRRFNIQLSNPKFGARLGQPHLATIIIGDRDEDELDQNFVSQTSSSPSPLHGNLGAPQNP
NAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESDAHLLDSKVPSVELTNLYPYCDYE
MKVCAYGAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQVSWAEPAETNGEITAY
EVCYGLVNEDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAI
INLATQPKRPMSIPIIPDIPIVDAQGGEDYENFLMYSDDVLRSPASSQRPSVSDDTGGSW
KFEPLLGEELDLRRVTWRLPPELIPRLSASSGRSSDAAEAPLGPPDDGAHPGAGNTGGEG
GSLPRSATPRPPGEHLVNGRMDFAFPGSANSLHRMTVANTAYGTHLSPHLPHRGLSTSST
LTRDYHSLTRTEHSHSASLPRDYSTLTSLSSHDSRLISGVPDTPTRLVFSALGPTSLKVS
WQEPQCDHTLQGYSVEYQLLNGGELHHLNIPNPNQTSVVVEDLLPNHSYVFRVRAQSQEG
WGREREGVITIESQVHPQSPLCPLPGSTFTLSTPSAPGPLVFTALSPESLQLSWERPRRP
NGDILGYLVTCEMAQGGGTATTFRVDGDNPESRLTVPGLSENVPYKFKVQARTTEGFGPE
REGIITIESQDGGPFPQLGSHPGLFQHPLQGEYSSVTTTHTSTTEPFLMDGLTLGSQRLE
AGGSLTRHVTQEFVSRTLTTSGTLSTQMDQQFFQT
Download sequence
Identical sequences H0WJM6
ENSOGAP00000001708 ENSOGAP00000001708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]