SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001810 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001810
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 1.26e-29
Family BTB/POZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 394-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000106
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 363-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000212
Family Classic zinc finger, C2H2 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001810   Gene: ENSOGAG00000002029   Transcript: ENSOGAT00000002030
Sequence length 467
Comment pep:known_by_projection scaffold:OtoGar3:GL873533.1:29587679:29589082:1 gene:ENSOGAG00000002029 transcript:ENSOGAT00000002030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCD
QVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCT
EVLEGNPTVLCQKLNHGSDHQSPSSSNYNGLVESFELGSGGHTDFPKAQELRDGENEEES
TKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSIMAH
KRWIHVKPERLEQACEGMDVHAAYDEHQVTESINTLQTEHSVQPSGVEEDFHIGEKKVEA
EFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEATLAAGYSENIEMVTGIKEE
ASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK
IHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN
Download sequence
Identical sequences H0WJW2
XP_012657819.1.62490 ENSOGAP00000001810 ENSOGAP00000001810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]