SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001913 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001913
Domain Number 1 Region: 2-384
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.2e-67
Family L-arabinose binding protein-like 0.0052
Further Details:      
 
Domain Number 2 Region: 405-518,637-776
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.28e-63
Family Phosphate binding protein-like 0.00000000288
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000001913
Domain Number - Region: 540-632
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000811
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001913   Gene: ENSOGAG00000002138   Transcript: ENSOGAT00000002141
Sequence length 890
Comment pep:known_by_projection scaffold:OtoGar3:GL873544.1:19735624:19952760:1 gene:ENSOGAG00000002138 transcript:ENSOGAT00000002141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHVIRIGGIFEYADGPNAQVMNAEEHAFRFSANIINRNRTLLPNTTLTYDIQRIHFHDS
FEATKKACDQLALGVVAIFGPSQGSCTNAVQSICNALEVPHIQLRWKHHPLDNKDTFYVN
LYPDYASLSHAILDLVQYLKWRSATVVYDDSTALGLIRLQELIMAPSRYNIRLKIRQLPI
DSDDSRPLLKEMKRGREFRIIFDCSHTMAAQILRQAMAMGMMTEYYHFIFTTLDLYALDL
EPYRYSGVNLTGFRILNVDNPHVSAIVEKWSMERLQAAPRAESGLLDGVMMTDAALLYDA
VHIVSVCYQRAPQMTVNSLQCHRHKAWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRTD
FDLDIISLKEDGLEKVGVWSPADGLNITEVAKGRGPNVTDSLTNRSLIVTTVLEEPFVMF
RKSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWNGMVKELID
HKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYV
LLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELM
PKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKD
GATMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRTLTADYALLMESTTIEYVTQR
NCNLTQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLHIMKEKWWRGSGCPEEE
NKEASALGIQKIGGIFIVLAAGLVLSVLVAVGEFVYKLRKTAEREQRSFCSTVADELRFS
LTCQRRLKHKPQPPMMVKTDAVINMHTFNDRRLPGKDSMACSTSLAPVFP
Download sequence
Identical sequences H0WK43
ENSOGAP00000001913 ENSOGAP00000001913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]