SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001964 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001964
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.27e-80
Family BAR domain 0.0000000226
Further Details:      
 
Domain Number 2 Region: 288-351
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-23
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001964   Gene: ENSOGAG00000002193   Transcript: ENSOGAT00000002198
Sequence length 354
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:17017925:17022424:-1 gene:ENSOGAG00000002193 transcript:ENSOGAT00000002198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTV
SKIRGQVKSPGYPQPEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIE
VKQNFIDPLQSLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGRIPDEELRQALDKFEESK
EVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELADKLKRRMREASSRPKRE
YKPKPRESFDLGEPEQSNGGFPCATAPKITASSSFRSSDKPIRTPSRTMPPLDQPSCKAL
YDFEPENDGELGFREGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ
Download sequence
Identical sequences H0WK88
ENSOGAP00000001964 ENSOGAP00000001964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]