SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002206 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002206
Domain Number 1 Region: 84-417
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.99e-104
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000000000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002206   Gene: ENSOGAG00000002466   Transcript: ENSOGAT00000002469
Sequence length 425
Comment pep:known_by_projection scaffold:OtoGar3:GL873570.1:4765109:4777464:1 gene:ENSOGAG00000002466 transcript:ENSOGAT00000002469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKMLAAVSRVLSGAAQKPVHADTPATPSQSPLSASLNVPNLYNWSHSIRETREASRVLV
ASRNFANDATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQK
IIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGC
AKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIF
EAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRVDGMDILCVREA
TRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMV
NNNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSNPPFEVRGANQWIK
FKSVS
Download sequence
Identical sequences H0WKS9
ENSOGAP00000002206 ENSOGAP00000002206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]