SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002490 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002490
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.67e-68
Family D-ribulose-5-phosphate 3-epimerase 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002490   Gene: ENSOGAG00000002778   Transcript: ENSOGAT00000002780
Sequence length 228
Comment pep:novel scaffold:OtoGar3:GL873532.1:21586467:21600646:-1 gene:ENSOGAG00000002778 transcript:ENSOGAT00000002780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences A0A1U7T3W9 A0A250YD19 H0WLG4
ENSOGAP00000002490 XP_003785032.1.62490 XP_004470261.1.11602 XP_008048556.1.4292 XP_008568627.1.73410 XP_020027911.1.5219 ENSDNOP00000002469 ENSOGAP00000002490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]