SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002492 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002492
Domain Number 1 Region: 209-593
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.1e-84
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.006
Further Details:      
 
Domain Number 2 Region: 641-866
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.08e-45
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002492   Gene: ENSOGAG00000002776   Transcript: ENSOGAT00000002782
Sequence length 1019
Comment pep:known_by_projection scaffold:OtoGar3:GL873638.1:5957544:6047228:1 gene:ENSOGAG00000002776 transcript:ENSOGAT00000002782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHLRTCAAKLRPLTASQTVKTFSQNRPPAARTFQQIRCYSAPVAAEPFLSGTSSNYVEE
MYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNV
DKLVEDHLAVQSLIRAYQVRGHHIAKLDPLGISCVNFDDAPVTVSSNVGFYGLDESDLDK
VFHLPTTTFIGGQESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIM
QFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDY
VIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRVTDR
NITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETF
HLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVM
YVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELL
VSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSC
PSTGLTEDILTHIGNVASSVPVENFTIHGGLSRILKTRGELVKNRTVDWALAEYMAFGSL
LKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYG
VLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGME
GMGPEHSSARPERFLQMCNDDPDILPDLKEANFDINQLYDCNWIVVNCSTPGNFFHVLRR
QILLPFRKPLIIFTPKSLLRHPEARTSFDEMLSGTHFQRVIPEDGPAAQNPENVKRLLFC
TGKVYYDLTRERKARGMVEQVAITRIEQLSPFPFDLLLKEVQKYPNAELVWCQEEHKNQG
YYDYVKPRLRTTISRAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFDLDAFKNFT
Download sequence
Identical sequences H0WLG6
ENSOGAP00000002492 ENSOGAP00000002492 XP_012665427.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]