SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002595 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002595
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 1.13e-84
Family Integrin A (or I) domain 0.0000000507
Further Details:      
 
Domain Number 2 Region: 371-457
Classification Level Classification E-value
Superfamily Integrin domains 2.51e-23
Family Integrin domains 0.00032
Further Details:      
 
Domain Number 3 Region: 621-704
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.35e-18
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000889
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 6 Region: 537-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.0000256
Family Integrin domains 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000002595
Domain Number - Region: 505-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0223
Family Integrin beta EGF-like domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002595   Gene: ENSOGAG00000002893   Transcript: ENSOGAT00000002899
Sequence length 787
Comment pep:known_by_projection scaffold:OtoGar3:GL873617.1:7240061:7318594:-1 gene:ENSOGAG00000002893 transcript:ENSOGAT00000002899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIGLFCLFFLLLRRNDHVQGGCAWGGAETCEDCLLIGPQCAWCFQENFTHPSGVGERCD
TPANLLAKGCLLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGEQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLHTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTQEEIANPCSSIPYSCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSRLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNMLLIFAVTREQVHLYENYAKLIPGATVGLLQEDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICANGIVFPHQKKCSHMKVGDTASFNVT
VNIPKCERSRHIIIKPVGLGDALEILISPECNCNCQKEVEVNSSKCHNGNGSFQCGVCAC
NPGHMGPHCECGEDMLSTDSCKETPDLPSCSGRGDCYCGQCICHLSPYGNIYGPHCQCDN
FSCVRHKGLLCGDNGDCDCGECVCRSGWTGEYCNCTSSTDSCISEDGVLCSGRGDCVCGK
CVCTNPGASGPTCERCPTCGDPCNSKRSCIECYLSADGQPREECLDKCKLAGAIISEEED
FSKDSSVSCSLQGENECLITFLITTDNEGRTIIHSIKEKDCPKPPNIPMIMLGVSLASLL
IGVVFLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQK
VDLSTDG
Download sequence
Identical sequences H0WLP6
ENSOGAP00000002595 ENSOGAP00000002595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]