SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002691 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002691
Domain Number 1 Region: 14-502
Classification Level Classification E-value
Superfamily ALDH-like 5.5e-144
Family ALDH-like 0.000000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002691   Gene: ENSOGAG00000003006   Transcript: ENSOGAT00000003009
Sequence length 520
Comment pep:known_by_projection scaffold:OtoGar3:GL873539.1:671854:686281:-1 gene:ENSOGAG00000003006 transcript:ENSOGAT00000003009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSQFSSKVKSTWYSASSFSSSVPTVKLFIDGKFVESKSDKWIDIHNPATNEVIGRVPQAT
KAEMDAAVASCKRAFPAWADTSVLSRQQVMLRYQQLIKDNLKEIAKLITLEQGKTLADAE
GDVFRGLQVVEHACSVTSLMLGETMPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWM
FPVAMVCGNTFLMKPSERVPGATMLLAKLLQDAGVPDGTLNIIHGQHEAVNFICDHPTIK
AISFVGSNQAGEYIFERGSKHGKRVQANMGAKNHGVIMPDANKENTLNQLVGAAFGAAGQ
RCMALSTAIFVGEAKKWLPELVERAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGT
KEGASLLLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPVLVVLETETLDEAI
KIVNDNPYGNGTAIFTTNGATARKYSHLVDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDT
NFYGKQGIQFYTQIKTITSQWKEDDATLSSPAVVMPTMGR
Download sequence
Identical sequences H0WLX5
ENSOGAP00000002691 ENSOGAP00000002691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]