SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002748 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002748
Domain Number 1 Region: 174-337
Classification Level Classification E-value
Superfamily E set domains 1.96e-31
Family Arrestin/Vps26-like 0.027
Further Details:      
 
Domain Number 2 Region: 11-173
Classification Level Classification E-value
Superfamily E set domains 1.4e-27
Family Arrestin/Vps26-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002748   Gene: ENSOGAG00000003067   Transcript: ENSOGAT00000003070
Sequence length 416
Comment pep:known_by_projection scaffold:OtoGar3:GL873536.1:24698296:24710249:-1 gene:ENSOGAG00000003067 transcript:ENSOGAT00000003070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWT
ESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERVLDDDNSEEGFNTIHSGRHEYAFSFEL
PQTPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKE
KTLCCWFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKG
KMKEVKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSILDCSIIRVEYSLMVYVDIPGA
MDLFLNLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLGLSLPERPEAPPSYAEVVTEEQR
RNNLAPVNACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPNPDQSSDDRPSCPSR
Download sequence
Identical sequences H0WM25
ENSOGAP00000002748 ENSOGAP00000002748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]