SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002834 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000002834
Domain Number - Region: 109-166
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00281
Family VPS37 C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002834   Gene: ENSOGAG00000003169   Transcript: ENSOGAT00000003170
Sequence length 251
Comment pep:known_by_projection scaffold:OtoGar3:GL873596.1:2514046:2517223:1 gene:ENSOGAG00000003169 transcript:ENSOGAT00000003170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLAS
NYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESTHRWSPHCALGWLQ
AELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQ
QAPTAAADPLKPFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLKGSPGCPLGPAPLLS
PRPSQPEPPHR
Download sequence
Identical sequences H0WM86
ENSOGAP00000002834 ENSOGAP00000002834 XP_003794245.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]