SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002840 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002840
Domain Number 1 Region: 44-175
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 4.7e-36
Family Methylmalonyl-CoA epimerase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002840   Gene: ENSOGAG00000003174   Transcript: ENSOGAT00000003177
Sequence length 176
Comment pep:known_by_projection scaffold:OtoGar3:GL873713.1:1405316:1435898:-1 gene:ENSOGAG00000003174 transcript:ENSOGAT00000003177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVLKAAAATVPGLFSRFQTSVPTLRAFFTSKPLHHVADPVWSLGRLNHVAIAVPDLEK
AATFYKNVLGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPIAGFLQKNKTGGM
HHVCIEVDNINAAVMDLKKKNIRSLSEEAKIGAHGKPVIFLHPKDCGGVLVELEQA
Download sequence
Identical sequences H0WM91
ENSOGAP00000002840 XP_003801064.1.62490 ENSOGAP00000002840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]