SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003018 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003018
Domain Number 1 Region: 57-260,333-358,395-520,569-594
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.89e-36
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 1359-1482
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000488
Family WD40-repeat 0.0039
Further Details:      
 
Domain Number 3 Region: 983-1234,1301-1337
Classification Level Classification E-value
Superfamily ARM repeat 0.0000366
Family HspBP1 domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003018   Gene: ENSOGAG00000003382   Transcript: ENSOGAT00000003385
Sequence length 1490
Comment pep:known_by_projection scaffold:OtoGar3:GL873546.1:17857494:18191374:-1 gene:ENSOGAG00000003382 transcript:ENSOGAT00000003385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNSLVLPIVLWGRKAPTHCISAVLLTDDGGTIVTGCHDGQICLWDLSVRLEVNPRALL
FGHTASITCLSKACASSDKQYIVSASESGEMCLWDVNDGRCIEFTKLACTHTGIQFYQFS
VGSQREGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAL
SATGILKVWIVASEISGTQDTEPIFEEESKPIYCQNCQSISFCGFTQRSLLVVCSKYWRV
FDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDV
GKAVENLIPPVQYSLLARKDKELLICPPVTRFFYGCKEYSHKLLIQGDSSGRLNIWDISD
TPDTQGGDEELKMTTSISLQEAFDKLIPRPAGIIDQLSVIPNSSEPLKVTASVYIPAHGR
LVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQVSPRY
DQRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLVPPENCSARVQHCICSVASDH
SVGLLSLREKKCIMLASRHLFPIHVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMG
ITAVEILNACDEAVPAAVDSLSHPAINLKQAMTRRSLAALKNVAHHKLQTLATNLLASEA
SDKGNLPKYSHNSLMVQAIKTNLTDPDIHVLFFDVEALIIQLLTEEASRPNTALISPENL
QKASGSSDKGGSFLTGKRAAVLFQQVKETIKENIKEHLLDDEEEDEETMRQRREESDPEY
RASKSKPLTLLEYNLTMDTAKLFMSCLHAWGLNEVLDEVCLDRLGMLKPHCTVSFGLLSR
GGHMSLMLPGHNQPSSKLSQGRTEVGRKQPATEGTEKGTYGVSRAVTTQHLLSIISLANT
LMSMTNATFIGDHMKKGPTRPPRPSTPDLSKTRGSPPTSSNIVQGQIKQVATPVVSARSA
ADHSGSDPASAPALHPCFLVNEGWSQLAAMHCVMLPDLLGLDRFRPPLLEMLARRWQDRC
LEVREAAQALLLAELRRIEQAGRKEAIDAWAPYLPQYMDHVISPGVTAEAMQTITTTSEA
SGPEAKVQEEEHDLADDDITTGCLSSVPQMKKISTSYEERRKQATAIVLLGVIGAEFGAE
IEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPAHSTIRRT
AIDLIGRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLNPAADSARSARHALS
LIATARPPAFITTIAKEVHRHTALAANTQSQQNIHTTTLARAKGEILRVIEILIEKMPTD
VVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERNHRIAVGARHGSVALY
DIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQ
LRCIKTYQVPPVQPASPGSHNALRLARLIWTSNRNVILMAHDGKEHRFMV
Download sequence
Identical sequences H0WMN8
ENSOGAP00000003018 XP_003788483.1.62490 ENSOGAP00000003018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]