SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003086 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003086
Domain Number 1 Region: 13-221
Classification Level Classification E-value
Superfamily PRTase-like 2.7e-49
Family Phosphoribosyltransferases (PRTases) 0.000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003086   Gene: ENSOGAG00000003466   Transcript: ENSOGAT00000003468
Sequence length 225
Comment pep:known_by_projection scaffold:OtoGar3:GL873538.1:9783686:9881685:1 gene:ENSOGAG00000003466 transcript:ENSOGAT00000003468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSEEAPDCGRGVVIMDSWPGYDLNLFTYPQHYYGDLDYVLIPHGVIVDRIERLAKDI
MKDIGYSDIMVLCVLKGGYKFCADLVEHFMNISRNSDRFISMKVDFIRLKSYRNDRSMEE
MQIIGGDDLSKLAGKPVLFAKDIVGTGQTMRALLSSLEKYKPNMVKVASLLVKRTPRSDG
FRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV
Download sequence
Identical sequences H0WMT7
ENSOGAP00000003086 ENSOGAP00000003086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]