SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003336 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003336
Domain Number 1 Region: 363-770
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-91
Family ALDH-like 0.000000136
Further Details:      
 
Domain Number 2 Region: 71-353
Classification Level Classification E-value
Superfamily Carbamate kinase-like 2.23e-50
Family PyrH-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003336   Gene: ENSOGAG00000003752   Transcript: ENSOGAT00000003756
Sequence length 795
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:24835012:24879210:1 gene:ENSOGAG00000003752 transcript:ENSOGAT00000003756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNQVYRCGFQPFNQRLLPWVQCTAVSRSHRVQPSAIRHVRSWSNIPFITVPLSRTHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPAEPNSDLQGVNV
ISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAG
PTVEQQGEMARSGGRTLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDMEEAEGRLAA
PLLKRLSLSTSKLNSLAIGLRQIASSSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIF
ESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLVNTRE
EVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKATRL
VRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSE
VKSLRTEYGDLELCIEVVDNVQEAIDHIHKYGSSHTDVIITENEKTAEFFLHHVDSACVF
WNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSL
KYLHENLPIPQRNTN
Download sequence
Identical sequences H0WNE0
XP_012659057.1.62490 ENSOGAP00000003336 ENSOGAP00000003336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]