SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003501 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003501
Domain Number 1 Region: 116-460
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.04e-26
Family WD40-repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 251-328,492-519,566-680,898-1013
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.96e-22
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 3 Region: 742-1085
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.42e-16
Family WD40-repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003501   Gene: ENSOGAG00000003935   Transcript: ENSOGAT00000003937
Sequence length 1121
Comment pep:known_by_projection scaffold:OtoGar3:GL873698.1:1248683:1257286:1 gene:ENSOGAG00000003935 transcript:ENSOGAT00000003937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALEDYVWPRATSELMLLPVTGLECVGDRLLAGEGPDVLVYSLDFGGHLRMMKRMQNLL
GHYLIHGFRVRPEPNGDLDAEAMVAVFGSKGLRIVKVSWGQGHFRELWRSGLWNMSDWIW
DARWLEGNVALALGHNSVVLYDPVVGCILQEVPCTDRCTLSSACLIGDTWKEVTIVAGAV
SNQLLVWYPAAALADNKPVAPDRRVSGHVGVIFSMSYLESKGLLATASEDRSVRIWKVGD
LRVPGGRVQSIGHCFGHSARVWQVKLLENYLISAGEDCVCLVWSHEGEILQAFRGHQGRG
IRAIAAHERQTWVITGGDDSGIRLWHLVGRGYPGSGVSALSFKSHSRPGTLKAVTLAGSW
RLLAVTDTGALYLYDLEIKCWEQLLEDKYFQSYCLLEAAPGPEGFGLCAMANGEGRVKVV
PINTPTAAVDQTLFPGKVHSLSWALRGYEELLLLASGPGGVVACLEISAAPSGKAIFVKE
RCRYLLPPSKQRWHTCSTFLPPGDFLVCGDRRGSVLLFPSRPGLLKDPGVGGKAGTGTGV
SGADSGSGEGGNAFVGWGPVSTLPSLHGKQGVTSVTCHGGYVYTTGRDGAYYQLFVRGGQ
LQPVLRQKSCRGMNWLAGLRMVPDGSMVILGFHANEFVVWSPRSHEKLHIVNCGGGHRSW
AFSDTEAAMAFAYLKDGDVMLYQALGGCTRPHVILREGLHGREITCVRRVGTITLGPEFG
VPSLMDPDNLEPGSEGPGLTDIVITCSEDTTVCVLALPTTTGSAHALTAVCNHISSVRAV
AVWGIGTPGGSQDPRPGLTAHVVSAGGRAEMHCFSILVTPDPSTPSRLACHVMHLTSHRL
DEYWDRQRNRHRMIKVDPETRYMSLAVCEFDRPGLGPLVAAACSDGAVRLFLLQNSGQFL
RLFAETFHHKRCVLKVHSFTHEAPNQRRRLFLCSAATDGNLAFWDLTTVLDCGSNALEPP
EDPGLPYRLGTPSLTVQAHSCGVNSLHTLPTNDGHHLVASGSEDGSIHVFMLAVEMPELE
EAVGEAEMVSQLRVLEEYSVPCAHAAHVTGLKILSPSLMVSASIDQRLTFWRLGHGEPTF
MNSTVYHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWYD
Download sequence
Identical sequences H0WNS9
XP_003800623.1.62490 ENSOGAP00000003501 ENSOGAP00000003501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]