SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003561 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003561
Domain Number 1 Region: 135-229
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.44e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 28-122
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.92e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003561   Gene: ENSOGAG00000003998   Transcript: ENSOGAT00000004001
Sequence length 231
Comment pep:known_by_projection scaffold:OtoGar3:GL873764.1:438381:441256:1 gene:ENSOGAG00000003998 transcript:ENSOGAT00000004001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGACQPFACFFAAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ
ALEKAYIKDCVTPSEYTAACSRLLVQYKAAFRQVQGSEINSIDEFCRKFRLDCPLAMERI
KEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHL
PPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences H0WNX7
ENSOGAP00000003561 ENSOGAP00000003561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]