SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003616 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003616
Domain Number 1 Region: 974-1176
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000371
Family WD40-repeat 0.026
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000003616
Domain Number - Region: 504-557
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00235
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003616   Gene: ENSOGAG00000004059   Transcript: ENSOGAT00000004063
Sequence length 1322
Comment pep:known_by_projection scaffold:OtoGar3:GL873681.1:248338:393954:-1 gene:ENSOGAG00000004059 transcript:ENSOGAT00000004063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLEN
LDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTR
VESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLH
QLSGSDQLESTAHSRIRKERPISLGIFPLPAGDGLLTPDTQKGGETPGSEQWKFQELSQP
RSHTSLKVSNSPEPVKAVEQEDELSDVSQGGSKATTPASTANSDVATIPTDTPLKEDNEG
FVKVTDTPNKSEISKHIEVQVAQETRNVSTGNAENEEKSEVQAIIESTPELDMDKDLSGY
KGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQL
LETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRRARAEA
EDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRE
NPAMQEKKRSSIWQFFSRLFSSSSNTAKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLP
GDKSKAFDFLSEETEASLALRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVTNG
QGENKMKNLPVPVYLRPLDEKDTSMKKLWCAVGVNLSGGKTRDGGSVIGASVFYKDVAGL
DTESSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVIIIDAVQPG
NILDSFTVCNSHILCIASVPGARETDYPAGEDLLESGQVDKASLCGSMTSNSSAETDSLL
GGITVVGCSAEGVTGAATSPSTNGASPVIEKPPETEPESSEVDENVPTAEEATEATEGNA
GSAEDTIDISQAGVYTEHVFTDPLGVQIPEDLSPVYQSSNDADAYKDQVSVLPSEQDLVR
EEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALAD
GTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIE
KSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTG
KLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGAPGNRPGSVIRVYGDENSD
KVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVVSPQSGNSGTDLTGDKAGPSTQE
PGSQTPSKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYG
SE
Download sequence
Identical sequences H0WP26
ENSOGAP00000003616 ENSOGAP00000003616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]