SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003693 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003693
Domain Number 1 Region: 360-584
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.19e-51
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 14-132
Classification Level Classification E-value
Superfamily POZ domain 7.22e-39
Family BTB/POZ domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003693   Gene: ENSOGAG00000004140   Transcript: ENSOGAT00000004143
Sequence length 584
Comment pep:known_by_projection scaffold:OtoGar3:GL873729.1:156149:199336:-1 gene:ENSOGAG00000004140 transcript:ENSOGAT00000004143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANEGCLNACDSPFSSDKHAQLMLAQINKMRNEYHFCDVQLQVGKETFQVHRLVLAASSP
YFAALFTGGMKESSKDVVQILGIEAGIFQVLLDFIYTGIVNISVNNVQELIVAADMLQLT
EVVNLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFTENYIHVHFLEVHCGEEFLALTK
DQLIKILRSEELSIEDEYQVFLAAMRWILKDLGKRRKYVVEVLDPIRFPLLPSQRLLKYI
EGVFDFNLRVALQTLLKEYCEVCKSPKENKFCSFLQPSKVRPRKKARKYLYAVGGYTRLQ
GGRWSDSRALSCVERFDTFSQYWTTVSSLHQARCGLGVAVLGGMVYAIGGEKDSMIFDCT
ECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGSEIGNTIERFDPDENKWEIV
GNMAVSRYYFGCCEMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGV
AALNDCIYSIGGWNETQDALHTVEKYSFEEEKWVEVASMKVPRAGMCVVAVNGLLYVSGG
RSSSHDFLAPSTLDSVEVYNPHSDTWTEIGNMITSRCEGGVAVL
Download sequence
Identical sequences H0WP95
ENSOGAP00000003693 XP_012667947.1.62490 ENSOGAP00000003693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]