SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003825 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003825
Domain Number 1 Region: 33-214
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.68e-67
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000014
Further Details:      
 
Domain Number 2 Region: 223-358
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.72e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003825   Gene: ENSOGAG00000004285   Transcript: ENSOGAT00000004288
Sequence length 359
Comment pep:known_by_projection scaffold:OtoGar3:GL873534.1:29335490:29341203:1 gene:ENSOGAG00000004285 transcript:ENSOGAT00000004288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSGLVRRPFQQVSGLLKRRFHRTVPAALQVTVRDAINQGMDEELERDERVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWSS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFELSTEAQSKDFLIPIGKAKIERQGTHITVV
SHSRPVGHCLEAATVLSKEGIECEVINMRTIRPMDIETVEASVMKTNHLITVEGGWPQFG
VGAEICAKIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNCIPQVKDIIFAIKKTLNI
Download sequence
Identical sequences H0WPK2
ENSOGAP00000003825 XP_003785588.1.62490 ENSOGAP00000003825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]