SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003851 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003851
Domain Number 1 Region: 289-558
Classification Level Classification E-value
Superfamily Kelch motif 8.37e-62
Family Kelch motif 0.0000601
Further Details:      
 
Domain Number 2 Region: 20-137
Classification Level Classification E-value
Superfamily POZ domain 3.14e-33
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003851   Gene: ENSOGAG00000004315   Transcript: ENSOGAT00000004317
Sequence length 568
Comment pep:known_by_projection scaffold:OtoGar3:GL873651.1:4276697:4415125:-1 gene:ENSOGAG00000004315 transcript:ENSOGAT00000004317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THSKHTSNIQEMLTGQRLCHSESHNDSVLAALNQQRSDGILCDVTLIAEEQKFHAHKAVL
AACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFAYTGQILLEPGVIQDVLAAGS
HLQLLELLNLCSHYLIQELNSFNYLDLYRLADLFNLTLLEKAVIDFLVKHLSELLKSRPE
DVLTLPYCLLQEVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQHLDELLQYIRFGLMDVDT
LHTVALSHPLVRASEAATALVNEALEYHQSIYAQPVWQTCRTKPRFQSDTLYIIGGKKRE
VCKVRELRYFNPVDQESALIAAIANWSELAPMPVGRSHHCVAVMGDFLFVAGGEVEHASG
RTCAVRTACRYDPRSNSWAEIAPMKNCREHFVLGAMDEYLYAVGGRNELRQVLPTVERYC
PKKNKWTFVQSFDRSLSCHAGYVADGLLWISGGVTNTAQYQNRLMVYEPNQNKWISRSPM
LQRRVYHSMAAVQRKLYVLGGNDLDYNNDRVLVRHIDSYNIDTDQWTRCDFNLLTGQNES
GVAVHNGRIYLVGGYSIWTNEPLACIQV
Download sequence
Identical sequences H0WPM4
ENSOGAP00000003851 ENSOGAP00000003851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]