SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003890 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000003890
Domain Number - Region: 80-119
Classification Level Classification E-value
Superfamily LysM domain 0.00131
Family LysM domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003890   Gene: ENSOGAG00000004357   Transcript: ENSOGAT00000004360
Sequence length 296
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:2316895:2319751:1 gene:ENSOGAG00000004357 transcript:ENSOGAT00000004360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQMEALTKTFQGPAVVCKTPTSHVYMFKNGSGDSGDSSEEEVHPVVLRPRGKERQKSGT
HHPHQLGAGEVVLLQRDLAQGDSLNKLALQYGCKVADIKKVNNFIREQDLFALKSIKIPV
KNHGILTETHKELKPLPNPSSETKVIMELPDPDREAADFDAQPKRLTDFFKGIDQNIERA
VQSEMFLQESCYVETSDLLLLPPPAKTRISGADCGIQWWNAVFIMLLIGVVLPVFYLIYF
KIQATSETPSNLNTTFVPNGSMAVGTIQGQAPRLVIPVPTVTSSDIQFSQTTHTGN
Download sequence
Identical sequences H0WPQ8
XP_012659900.1.62490 ENSOGAP00000003890 ENSOGAP00000003890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]