SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003994 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003994
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 7.38e-101
Family Carbonic anhydrase 0.000000000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003994   Gene: ENSOGAG00000004474   Transcript: ENSOGAT00000004476
Sequence length 260
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:39458498:39474051:-1 gene:ENSOGAG00000004474 transcript:ENSOGAT00000004476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHWGYGKHNGPEHWHKDFPIAKGQRQSPVDIDTGAAKYDPSLKPLQVGYEKVTSRRIV
NNGHSFNVEFDDSQDKATLKGGPLDGTYRLIQFHFHWGSVDQQGSEHTVDKKKYAAELHL
VHWNTKYGDFGKAVQHPDGLAVLGVFMKVGSAKPGLQKVLDALDSIKTKGKSADFTDFDP
RGLLPGNLDFWTYPGSLTTPPLLECVTWIVLKEPISVSSEQMLKFRKLNFNKAGEPEELM
VDNWRPVQSLNNRQIKASFQ
Download sequence
Identical sequences H0WPZ3
XP_003782556.1.62490 ENSOGAP00000003994 ENSOGAP00000003994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]