SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004290 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004290
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily POZ domain 1.26e-24
Family BTB/POZ domain 0.0031
Further Details:      
 
Domain Number 2 Region: 908-960
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000131
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 851-903
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000042
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 1005-1056
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000778
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 1103-1154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000052
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 827-860
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000616
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000004290
Domain Number - Region: 755-806
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000101
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 975-1015
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000277
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 1158-1186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00371
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number - Region: 1073-1115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0051
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004290   Gene: ENSOGAG00000004797   Transcript: ENSOGAT00000004800
Sequence length 1269
Comment pep:known_by_projection scaffold:OtoGar3:GL873528.1:2951263:2987982:-1 gene:ENSOGAG00000004797 transcript:ENSOGAT00000004800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPNYSRQLLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAASLLFKTLLDNTDTIS
IDASVVSPEEFALLLEMMYTGRLPVGKHNFSKIISLADSLQMFDVAVSCKNLLTSLVNCS
VQGQVVRDVSTLPSESIRKESEKTQVEILSLEGAGESHSPEVSAPPGGPVKAETKEAIRT
VTQEMSVDPPPAREVQGNADTPVETPNTAEVCSPPPVVQTFSEAKETSTEPECERKHNQL
NFLLENETVFSDALMVTQDVLKRLEVCAEIKGPQKETIMKCLEAEEGHSAFQKILDKVRD
ESLDVQTVVSLLRLYQDSNPAVKTALLNRKPEGSTEEGKTLSVLLLEHKEDLIRCVTQLR
PIVEFLETAKEEFLTGAEKRVILNCCEGGTPKETIENLLHRMTEGKTLTAESLVKLLQAV
KKTFPNLGLLLENLQKLATLPSTAGISYISRINNDLLEPNRLAQRANKQSPVRPSLDDFG
TELLRRYHENLSEIFPDNQMLLKVVSHMTSLAPGEREVIEKLVKRDSGSGGFSSLMSAVL
DKQALSATTIWQLLLVAQETKTCPLNLLVEEIRREPGADAFFRAVTTPESAALEICLRHS
KLILEAIQQRMELKCFNSEEEHLAETVKEILSISSETASPEASLRAALSKTMEKSVSAIE
ICHLLCSVHKSFPGLQPIMQELAYLGFLTKENGEKEAWKVSKKFHLEANDKEDGKAVEPA
EEDCQSREQNDQGETGSLPGQQEKDTSASPDSAKKNFVCKACDKSFHFYCRLKVHMKRCR
VAKSKQVQCKECSETKDSKKELEKHQLEAHGAGGEPDIPKKKKKRLPVTCDLCGREFAHA
SGMQYHKLTEHFDEKPFSCEECGAKFAANSTLKNHLRLHTGDRPFMCKHCLMTFTQASAL
AYHTKKKHSEGKMYACQYCDAVFAQSIELSRHVRTHTGDKPYVCRDCGKGFRQANGLSIH
LHTFHRMSLMKPDIEDPYDCKKCRMSFPTLQDHRKHIHEVHSKEYHPCPTCGKIFSAPSM
LERHMVTHVGGKPFSCGICNKAYQQLSGLWYHNRTHHPDVFAAQNHRSSKFSSFQCSSCD
KTFPNTIEHKKHIKAEHHFTDMKFHECDQCKELFPTPALLQVHVKCQHSGSQPFRCLYCA
ATFRFPGALQHHVTTEHFKQSESTFPCELCGELFTSQAQLDSHLESEHPKVVGTETQAAA
SQMVQVIQASEPGAPAEQVITLEETQLAGSQVFVTLPDSQTSQTSSELVAVTVEDLLDGT
VTLICGEAK
Download sequence
Identical sequences H0WQP7
ENSOGAP00000004290 ENSOGAP00000004290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]