SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004410 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004410
Domain Number 1 Region: 361-471,582-705
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.67e-43
Family Phosphate binding protein-like 0.0000307
Further Details:      
 
Domain Number 2 Region: 1-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.49e-25
Family L-arabinose binding protein-like 0.007
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000004410
Domain Number - Region: 467-581
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00196
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004410   Gene: ENSOGAG00000004937   Transcript: ENSOGAT00000004942
Sequence length 706
Comment pep:known_by_projection scaffold:OtoGar3:GL873595.1:8990363:9532902:1 gene:ENSOGAG00000004937 transcript:ENSOGAT00000004942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDD
YTLSVRPPVYLNDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVE
NNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIII
NEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNME
ISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKKGGVNGL
TGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWNPVTGLNGSLTDKKLENNMRGV
VLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGSPQE
DGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFAC
LAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGG
EVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQTDIPYGT
VLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQKVKYGNYAFVW
DAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPYRDVFSQR
Download sequence
Identical sequences H0WQZ2
ENSOGAP00000004410 ENSOGAP00000004410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]