SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004458 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004458
Domain Number 1 Region: 51-304
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.76e-77
Family Carbonic anhydrase 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004458   Gene: ENSOGAG00000004991   Transcript: ENSOGAT00000004993
Sequence length 333
Comment pep:known_by_projection scaffold:OtoGar3:GL873681.1:836800:1317347:-1 gene:ENSOGAG00000004991 transcript:ENSOGAT00000004993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGIRSRSGCGLTEPDGLYMMGMKVLAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNS
AWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLV
NISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKS
PNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITY
DGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNR
CIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Download sequence
Identical sequences H0WR30
ENSOGAP00000004458 ENSOGAP00000004458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]