SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004496 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004496
Domain Number 1 Region: 392-598
Classification Level Classification E-value
Superfamily HCP-like 6.54e-44
Family HCP-like 0.00041
Further Details:      
 
Domain Number 2 Region: 199-382
Classification Level Classification E-value
Superfamily HCP-like 2.09e-24
Family HCP-like 0.0031
Further Details:      
 
Domain Number 3 Region: 569-692
Classification Level Classification E-value
Superfamily HCP-like 1.96e-21
Family HCP-like 0.0061
Further Details:      
 
Domain Number 4 Region: 117-170
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004496   Gene: ENSOGAG00000005031   Transcript: ENSOGAT00000005034
Sequence length 797
Comment pep:known_by_projection scaffold:OtoGar3:GL873539.1:7938042:8003662:-1 gene:ENSOGAG00000005031 transcript:ENSOGAT00000005034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRIGLTLLLCAVLLGSALATSDEEGSQDESLDSKSDIQGGQSVMNKTTTGRVVAGQIF
LDSEESELESNIQEEEDSLKSQEGESGTEEISFLESSNSESKNYEEPKKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLTQNIQ
VAKEMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQNFISLGQHQIHIYQMRDQNSEQRAFDYFNLAANAGNSHAMAFLG
KMYSEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKA
AEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMR
SCHTAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFIL
DQREATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLA
SEQQHSAQAMFNLGYMHEKGLGIKQLLKLSLLFSRLKLGSNPPAQAYKFIRLQSPGRVGL
CSPVSETHIRDMFTQLDMDQILGPEWDLYLMTIIALLLGTVIAYRQRQHQDVPVPRPPGP
RPAPPQQEGPPEQQPPQ
Download sequence
Identical sequences H0WR61
ENSOGAP00000004496 ENSOGAP00000004496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]