SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004573 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004573
Domain Number 1 Region: 224-385,446-508
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-39
Family Voltage-gated potassium channels 0.0049
Further Details:      
 
Domain Number 2 Region: 511-695
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-35
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.64e-21
Family Flavin-binding PAS domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004573   Gene: ENSOGAG00000005113   Transcript: ENSOGAT00000005115
Sequence length 1084
Comment pep:known_by_projection scaffold:OtoGar3:GL873589.1:9761966:9782968:1 gene:ENSOGAG00000005113 transcript:ENSOGAT00000005115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISDTKNRGGPDRWKETGGGRRRYGRAGAKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACIWFYIGQREIESSESELPEIGWLQELARRLETPYYLVGQSSDGG
NNSGQNDNCSSGSSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEK
IFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRML
EYFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALR
PAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRREQVVKAN
ADVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGGTAEVDTSSLS
GDNTLMSTLEEKETDGEQGPAASPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRSRL
GGRGRPGRAGASKTEAGPSAPPRTLEGLQLPTMPWNLPPDLSPRVVDGIEDGCSSDQPKF
SFRVGQSGPECSSSPSPGPESGLLTVPLGPGEARNTDTLDKLRQAVVELSEQVLQMREGL
QSLRQAVQLVLTPHREGLCPQEPGEGPCPASASGLLQPLCVDTGASSYCLQPPAGSALSG
TWPHPHPGPPPLMAPWPWGPPASQSSPWPRATAFWTSTSDSEPPGSGELGSEPSTPASPP
PSEEGARTGPPEPVSQAEATSTGEPPPGSGGLALPWDPHSLEMVLIGCHGSGTVQWTQEE
GTGV
Download sequence
Identical sequences H0WRC6
XP_003793661.1.62490 ENSOGAP00000004573 ENSOGAP00000004573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]