SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004676 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004676
Domain Number 1 Region: 320-377
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.39e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 9-51
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000152
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004676   Gene: ENSOGAG00000005229   Transcript: ENSOGAT00000005232
Sequence length 377
Comment pep:known_by_projection scaffold:OtoGar3:GL873539.1:7628071:7662843:-1 gene:ENSOGAG00000005229 transcript:ENSOGAT00000005232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WANCSISYLLPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SEEQQLLLQVQQQHQPQQPQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIV
PDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIIQPQQ
SVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPPQILFTGNKTQVIPTTV
AAPTQAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDFDDDDEEEDK
EKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMN
LNGRDYIFSKAIGDAEW
Download sequence
Identical sequences H0WRL7
ENSOGAP00000004676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]