SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004686 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004686
Domain Number 1 Region: 356-701
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.05e-133
Family Transferrin 0.000000000109
Further Details:      
 
Domain Number 2 Region: 21-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.62e-124
Family Transferrin 0.000000000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004686   Gene: ENSOGAG00000005240   Transcript: ENSOGAT00000005242
Sequence length 702
Comment pep:known_by_projection scaffold:OtoGar3:GL873551.1:4214284:4238786:1 gene:ENSOGAG00000005240 transcript:ENSOGAT00000005242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAVSALLACAVLGLCLAVPEKTVRWCAVSDHEASKCHGFRDNMKKVLPDGVRVSCVKK
ASHLDCIKAIAANEADAVTLDAGWVYEAGLTPNNLKPVVAEVYGSKDNPLTYYYAVAVVK
KGSGFQWNELRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRQPLERAVANFFSGSCVPCA
DGDSFPQLCQLCAGCGCSSLQPYFGYSGAFKCLKDDVGEVAFVKHLTVFENLPNKADRDQ
YELLCLDNTRKPVDDFENCHLAKVPSHAVVARTVDGKEDLIWELLNQAQEHFGRDKSDDF
QLFSSSLGKDLLFKDSAQGFLRVPSRMDFRLYLGYEYVTALRNLREGTCPETSTKECNTV
KWCALSHHERLKCDEWTVHSGGKIECESAETTEDCIAKIMNGEADAMSLDGGYVYIAGKC
GLMPVMAENYENYENSGKCTENPEEGYFAVAVVKKSSADLTWNTLKGKKSCHTAVDRTAG
WNIPMGLLYNELNHCRFDEFFSQGCAPGSPKNSSLCELCMGPNPNECKANSKEGYYGYTG
AFRCLVEKGDVAFVKSQTIEQNTNGKNAEPWAKDLKDSEFELLCLDGTRKSVGEVKNCHL
ARGPNHAVVTRKDKAACVRQTLRHQEQQGEFGYFSPDCSKKFCMFQSDTKDLLFKDNTRC
LAQIQDGVKYDKYLGEEYVKAVGNLRKCSTSQLLQACTFHRV
Download sequence
Identical sequences H0WRM6
ENSOGAP00000004686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]