SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004705 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004705
Domain Number 1 Region: 406-696
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.4e-75
Family Protein kinases, catalytic subunit 0.000000312
Further Details:      
 
Domain Number 2 Region: 248-331
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-34
Family Kringle modules 0.00038
Further Details:      
 
Domain Number 3 Region: 2-91
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-21
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000004705
Domain Number - Region: 107-194
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00249
Family Frizzled cysteine-rich domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004705   Gene: ENSOGAG00000005259   Transcript: ENSOGAT00000005263
Sequence length 876
Comment pep:known_by_projection scaffold:OtoGar3:GL873585.1:10645848:10840772:1 gene:ENSOGAG00000005259 transcript:ENSOGAT00000005263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNITTSLGQTAELHCRVSGNPPPTIRWFKNDAPVVQEPRRISFRATSYGSRLRIRNLDT
TDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGYSEEYEEDGFCQPYRGIACARFIG
NRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDDSSSAPK
PRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCDDLPQPESPEAANCIRIGIPM
ADPINKNHKCYNNTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTAIHFPELNGGHSYCR
NPGNQKEAPWCFTLDENFKSDLCDIPACDPDSKDSKEKNKMEILYILVPSVAIPLAIALL
FFFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGE
CAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGA
VTQEQPVCILFEYTDRGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAA
GMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMPP
EAILYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRM
YSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSNL
SNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPAGP
PRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPSGMGITV
FSNKSQKPYKIDSKQPSLLGDSNIHGHTESMISAEL
Download sequence
Identical sequences H0WRP1
ENSOGAP00000004705 ENSOGAP00000004705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]