SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004854 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004854
Domain Number 1 Region: 237-478
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.65e-55
Family Decarboxylase 0.000000565
Further Details:      
 
Domain Number 2 Region: 14-204
Classification Level Classification E-value
Superfamily PRTase-like 2.98e-44
Family Phosphoribosyltransferases (PRTases) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004854   Gene: ENSOGAG00000005426   Transcript: ENSOGAT00000005427
Sequence length 480
Comment pep:known_by_projection scaffold:OtoGar3:GL873608.1:1012851:1025408:-1 gene:ENSOGAG00000005426 transcript:ENSOGAT00000005427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAGDALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQIADILFQT
AQNEGISFDTVCGVPYTALPLATVMCSTNQIPMLIRRKETKDYGTKRLVEGAVNPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAVVLLDREQGGKDKLQAHGIRLHSVCTLSRIL
EILEQQKKIDTEMVGRVKRFVQENVFVTTNQNGSLLCIKKASKELSFGARAELPGIHPVA
SKLLRLMQRKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILDDFTLDVMEELTM
LAQRHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADVVNAHVVPGSGVVKGLREVGLP
LHRGCLLIAEMSSAGSLATGNYTKAAVRMAEEHSEFVIGFISGSRVSMKPEFLHLTPGVQ
LEAGGDTLGQQYNSPQEVISKRGSDIIIVGRGIISAANRLEAAEIYRKVAWEAYLNRLGI
Download sequence
Identical sequences H0WS16
ENSOGAP00000004854 ENSOGAP00000004854 XP_003795119.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]