SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004914 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004914
Domain Number 1 Region: 300-564
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.28e-82
Family Eukaryotic proteases 0.00000000222
Further Details:      
 
Domain Number 2 Region: 106-211
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-33
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 3 Region: 215-303
Classification Level Classification E-value
Superfamily Kringle-like 2.1e-29
Family Kringle modules 0.0000254
Further Details:      
 
Domain Number 4 Region: 37-86
Classification Level Classification E-value
Superfamily FnI-like domain 2.09e-18
Family Fibronectin type I module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004914   Gene: ENSOGAG00000005493   Transcript: ENSOGAT00000005496
Sequence length 565
Comment pep:known_by_projection scaffold:OtoGar3:GL873716.1:394888:408833:1 gene:ENSOGAG00000005493 transcript:ENSOGAT00000005496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSKMVSTLLCVLLLCGVACTLASQDIHTRFRRGARSSQATCRDEKTQMVYQLHESWLRP
MLRGRRVEYCWCDGNRARCHSVPVKSCSEPRCFNGGTCWQALYFSHFVCQCPEGFTGTRC
EIDARATCYEDQGVTYRGTWSTTESGADCVNWNSSTLAWKPYNGRRPDAVRLGLGNHNYC
RNPDRDSKPWCYVFKAGKYTSEFCSTPACSKGQNGDCYFDKGSAYRGRHSLTTSGASCLP
WNSVILKGKIYTAWKSNAPALGLGRHNYCRNPDNDAKPWCHVVKDRKLTWEYCDVPQCST
CGLRQYKQPQFLIKGGFLTDITSHPWQAAIFAKNRRSPGERFLCGGILIHSCWVLSAAHC
FQERVPLHHLKVILGRTYRLIPGKEEQEFEVEKYIVHKEFDDDTYNNDIALLQLKSDSLS
RCAQESVAVRTVCLPPPSLTLPDWTECELSGYGKHEQSSPFYSEQLKEAHVRLYPASRCT
SQHLFNRTVTSNMLCAGDTRTGGNQPNLHDACQGDSGGPLVCLKDNRMTLVGIISWGLGC
GQKDVPGVYTKVTNYLDWIRDNMRP
Download sequence
Identical sequences H0WS66
ENSOGAP00000004914 ENSOGAP00000004914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]